PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G32510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 588aa    MW: 61551.3 Da    PI: 7.1349
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G32510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.72.4e-24208252145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  OGLUM03G32510.1 208 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 252
                      79****************************************986 PP

2QLQ57.44.4e-20142178137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q+ +L++Q+l+yKyLaan PvP+ Ll +i++
  OGLUM03G32510.1 142 GPFTPSQWIELEHQALIYKYLAANSPVPHSLLIPIRR 178
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-11142178IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-14143177IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.087143178IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.455208252IPR014977WRC domain
PfamPF088792.1E-20209251IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MQRYRHPTLK EGAVVGGGDG PGWRGGGGDG GGGRGCAVEA DTVAELQGAA VAAAAAVSEA  60
VKVAAPFLLG ASCSPGHGGE QMLSFSSSAS SCSSGGGGAA VAAAAAAGGA MPLYYGTPAS  120
CSGLSSVSLS SSMQGAMARV RGPFTPSQWI ELEHQALIYK YLAANSPVPH SLLIPIRRSL  180
TSPYSPAYFG SSTLGWGSFQ LGYSGSADPE PGRCRRTDGK KWRCSRDAVA DQKYCERHMN  240
RGRHRSRKHV EGQPGHAAKA MPAAVAAAAA SATQPSAPAA HSGGAVAGLA INHQHQQMKN  300
YAANTANPCS LQYSRDLANK HNESEQVQDS DSLSMLTSIS TRNTGSLFPF SKQHNPFEVS  360
NSRPDFGLVS PDSLMSSPHS SLENVNLLTS QSLNEQQSSV SLQHFVDWPR TPAQGALAWP  420
DAEDMQAQRS QLSISAPMAS SDLSSASTSP IHEKLMLSPL KLSREYSPIG LGFAANRDEV  480
NQGEANWMPM FRDSLMGGPL GEVLTKNNNM EARNCLSESL NLLNDGWDSS SGFDSSPVGV  540
LQKTTFGSVS SSTGSSPRLE NHSVYDGNSN LRDDLGSVVV NHPSIRLV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12333RGGGGDGGGGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0735780.0AK073578.1 Oryza sativa Japonica Group cDNA clone:J033048N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628630.10.0PREDICTED: growth-regulating factor 6
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLA0A0D9ZCM10.0A0A0D9ZCM1_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g51970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.13e-53growth-regulating factor 1